This sequence alignment would be typical of the type of data to be submitted with a request for addition of a "new" PDE to the PDE database. In this case it compares the "conserved catalytic domain" of HSPDE7A, (defined here as an approximately 250 amino acid starting 25-30 amino acids N-terminal to the conserved HNHxxH motif) to the closest sequence currently in the database. In this case the PDE4B2A is compared using the University of Wisconsin GCG software. The output can be pasted directly into a text file that will work well on most email systems.
of: HSPDE7A.Pep from: 201 to: 450 LOCUS HUMCAMPHOS 3979 bp ss-mRNA PRI 03-AUG-1993 DEFINITION Human cAMP phosphodiesterase mRNA ACCESSION L12052 to: HSPDE4B2A.Pep from: 1 to: 565 Symbol comparison table: Gencoredisk:[Gcgcore.Data.Rundata]Swgappep.Cmp CompCheck: 1254 Gap Weight: 3.000 Average Match: 0.540 Length Weight: 0.100 Average Mismatch: -0.396 Quality: 196.2 Length: 256 Ratio: 0.791 Gaps: 2 Percent Similarity: 63.306 Percent Identity: 39.113 HSPDE7A.Pep x HS4B2A.Pep December 15, 1994 11:25 .. . . . . . 203 FHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANS 252 |::. .: ::: :::.|||: :|||.:|||||.|. |..|..| |.. 209 FRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAV 258 . . . . . 253 VTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHW 302 .|.::|| .::|||.||:|||||...|||.|| || :|.:.|||||||: 259 FTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL 308 . . . . . 303 RSAVGLLRE..SGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFR 350 :. ||.| :::| :|. . || : . : .::||||:|:: ..|. :: 309 AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLK 358 . . . . . 351 SHLD......RGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSE 394 . :: .| | |:: .| ||. :.|||::||.:.:|| :||.: 359 TMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTD 408 . . . . . 395 KVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEW 444 :: ||||:||| |:. :::||:||:||.|:.. |:||:.|:|.||:..| 409 RIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW 458 445 ARFSNT 450 | : .. 459 ADLVQP 464
Since the identity in the most conserved region is only 39%, it is clear from the comparison that this cDNA should encode a PDE belonging to a different PDE family from the PDE4s. When supported by expression data it is clear that it encodes a catalytically active PDE.